PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca22439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 188aa    MW: 21036.7 Da    PI: 4.906
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca22439.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.8e-4291081100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++hk+FGasn++kll++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+aela+ ++
  Dca22439.1   9 PCAACKILRRRCAEKCVLAPYFPPTDPLKFTIAHKVFGASNIIKLLQELPEAQRADAVSSMVYEANARLRDPVYGCAGAICQLQKQVNELQAELAKSRA 107
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  Dca22439.1 108 E 108
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.2288109IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-429105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MTPTIIMSPC AACKILRRRC AEKCVLAPYF PPTDPLKFTI AHKVFGASNI IKLLQELPEA  60
QRADAVSSMV YEANARLRDP VYGCAGAICQ LQKQVNELQA ELAKSRAEMV NLQCQQANLL  120
ALICMQDNNN NNNNNNNNNN NYNSNINING SQVTPTSPEN DSFETSTNFL NFYDDNNVNN  180
SMWEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010669677.12e-91PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-73LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK084e-73LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0J8CVC62e-91A0A0J8CVC6_BETVU; Uncharacterized protein
STRINGGLYMA11G15810.18e-83(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-67LOB domain-containing protein 1